SCOPe 2.08: Domain d2fmlb1: 2fml B:205-269

Lineage for d2fmlb1 (2fml B:205-269)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
   PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins

6. Protein Hypothetical protein EF2700, C-terminal domain [140302] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140303] (1 PDB entry)
   Uniprot Q830S2 205-268

8. Domain d2fmlb1: 2fml B:205-269 [133780]
   Other proteins in same PDB: d2fmla2, d2fmlb2
   automated match to d2fmla1
   complexed with gol

Details for d2fmlb1

PDB Entry: 2fml, 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis

PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d2fmlb1:

Sequence, based on SEQRES records:

>d2fmlb1 a.4.5.68 (B:205-269) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpvgigrpski
yqlkt

Sequence, based on observed residues (ATOM records):

>d2fmlb1 a.4.5.68 (B:205-269) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpskiyqlkt

Timeline for d2fmlb1:

• d2fmlb1 first appeared in SCOP 1.73
  
• d2fmlb1 appears in SCOPe 2.07