PDB entry 2fml

View 2fml on RCSB PDB site
Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: MutT/nudix family protein, Enterococcus faecalis, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-01-09, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAO82404
      • modified residue (43)
      • modified residue (200)
      • modified residue (243)
    Domains in SCOPe 2.07: d2fmla1, d2fmla2
  • Chain 'B':
    Compound: MutT/nudix family protein
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAO82404
      • modified residue (43)
      • modified residue (200)
      • modified residue (243)
    Domains in SCOPe 2.07: d2fmlb1, d2fmlb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmlA (A:)
    mpqfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvll
    iqrkghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdpr
    gwvvtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkd
    tlafdhseiiikafnrvvdkmehepqvlqvlgkdftitearkvfakflgvdyrsidhsnf
    kkamtqyfeelgerpvgigrpskiyqlktttgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmlA (A:)
    qfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliq
    rkghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgw
    vvtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtl
    afdhseiiikafnrvvdkmehepqvlqvlgkdftitearkvfakflgvdyrsidhsnfkk
    amtqyfeelgepskiyqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmlB (B:)
    mpqfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvll
    iqrkghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdpr
    gwvvtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkd
    tlafdhseiiikafnrvvdkmehepqvlqvlgkdftitearkvfakflgvdyrsidhsnf
    kkamtqyfeelgerpvgigrpskiyqlktttgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmlB (B:)
    faskaeeknyyerqaslaefltwyhqqyekpsltvdmvllcynkeadqlkvlliqrkghp
    frnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgwvvtvs
    ylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtlafdhs
    eiiikafnrvvdkmehepqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqy
    feelgerpskiyqlkt