| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.68: Nudix-associated domain [140299] (2 proteins) PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins |
| Protein Hypothetical protein EF2700, C-terminal domain [140302] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [140303] (1 PDB entry) Uniprot Q830S2 205-268 |
| Domain d2fmla1: 2fml A:205-268 [133778] Other proteins in same PDB: d2fmla2, d2fmlb2 complexed with gol |
PDB Entry: 2fml (more details), 2.26 Å
SCOPe Domain Sequences for d2fmla1:
Sequence, based on SEQRES records: (download)
>d2fmla1 a.4.5.68 (A:205-268) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpvgigrpski
yqlk
>d2fmla1 a.4.5.68 (A:205-268) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgepskiyqlk
Timeline for d2fmla1: