Lineage for d2fmla1 (2fml A:205-268)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694388Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
    PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins
  6. 2694398Protein Hypothetical protein EF2700, C-terminal domain [140302] (1 species)
  7. 2694399Species Enterococcus faecalis [TaxId:1351] [140303] (1 PDB entry)
    Uniprot Q830S2 205-268
  8. 2694400Domain d2fmla1: 2fml A:205-268 [133778]
    Other proteins in same PDB: d2fmla2, d2fmlb2
    complexed with gol

Details for d2fmla1

PDB Entry: 2fml (more details), 2.26 Å

PDB Description: Crystal structure of MutT/nudix family protein from Enterococcus faecalis
PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d2fmla1:

Sequence, based on SEQRES records: (download)

>d2fmla1 a.4.5.68 (A:205-268) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgerpvgigrpski
yqlk

Sequence, based on observed residues (ATOM records): (download)

>d2fmla1 a.4.5.68 (A:205-268) Hypothetical protein EF2700, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
pqvlqvlgkdftitearkvfakflgvdyrsidhsnfkkamtqyfeelgepskiyqlk

SCOPe Domain Coordinates for d2fmla1:

Click to download the PDB-style file with coordinates for d2fmla1.
(The format of our PDB-style files is described here.)

Timeline for d2fmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fmla2