Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
Domain d2fdbp2: 2fdb P:2251-2360 [133299] Other proteins in same PDB: d2fdbm1, d2fdbn_ automated match to d1ev2g2 |
PDB Entry: 2fdb (more details), 2.28 Å
SCOPe Domain Sequences for d2fdbp2:
Sequence, based on SEQRES records: (download)
>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl
>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvnttdke ievlyirnvtfedageytclagnsigisfhsawltvl
Timeline for d2fdbp2:
View in 3D Domains from other chains: (mouse over for more information) d2fdbm1, d2fdbn_, d2fdbr1, d2fdbr2 |