SCOP 1.73: Domain d2fdbp2: 2fdb P:2252-2360

Lineage for d2fdbp2 (2fdb P:2252-2360)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (4 PDB entries)

8. Domain d2fdbp2: 2fdb P:2252-2360 [133299]
   automatically matched to d1cvsc2

Details for d2fdbp2

PDB Entry: 2fdb, 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c

PDB Compounds: (P:) Fibroblast growth factor receptor 2

SCOP Domain Sequences for d2fdbp2:

Sequence, based on SEQRES records:

>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
srhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkv
lkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records):

>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
srhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvnttdkei
evlyirnvtfedageytclagnsigisfhsawltvl

Timeline for d2fdbp2:

• d2fdbp2 is new in SCOP 1.73
  
• d2fdbp2 appears in SCOP 1.75
  
• d2fdbp2 appears in the current release, SCOPe 2.08