Lineage for d2fdbp2 (2fdb P:2251-2360)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753637Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2753651Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2753664Domain d2fdbp2: 2fdb P:2251-2360 [133299]
    Other proteins in same PDB: d2fdbm1, d2fdbn_
    automated match to d1ev2g2

Details for d2fdbp2

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (P:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbp2:

Sequence, based on SEQRES records: (download)

>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records): (download)

>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvnttdke
ievlyirnvtfedageytclagnsigisfhsawltvl

SCOPe Domain Coordinates for d2fdbp2:

Click to download the PDB-style file with coordinates for d2fdbp2.
(The format of our PDB-style files is described here.)

Timeline for d2fdbp2: