SCOPe 2.08: Domain d2fdbp2: 2fdb P:2251-2360

Lineage for d2fdbp2 (2fdb P:2251-2360)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)

8. Domain d2fdbp2: 2fdb P:2251-2360 [133299]
   Other proteins in same PDB: d2fdbm1, d2fdbn_
   automated match to d1ev2g2

Details for d2fdbp2

PDB Entry: 2fdb, 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c

PDB Compounds: (P:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbp2:

Sequence, based on SEQRES records:

>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl

Sequence, based on observed residues (ATOM records):

>d2fdbp2 b.1.1.4 (P:2251-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvnttdke
ievlyirnvtfedageytclagnsigisfhsawltvl

Timeline for d2fdbp2:

• d2fdbp2 first appeared in SCOP 1.73
  
• d2fdbp2 appears in SCOPe 2.07