![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
![]() | Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
![]() | Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
![]() | Protein Hypothetical protein NE1496 [143489] (1 species) shape-shifter; open beta-sheet instead of beta-barrel |
![]() | Species Nitrosomonas europaea [TaxId:915] [143490] (1 PDB entry) Uniprot Q82UI9 2-151 |
![]() | Domain d2fblb_: 2fbl B: [133250] automated match to d2fbla1 complexed with na |
PDB Entry: 2fbl (more details), 1.9 Å
SCOPe Domain Sequences for d2fblb_:
Sequence, based on SEQRES records: (download)
>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqey eiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflseda aqafipppwfgeevtedkryknkalalsip
>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseggrqeyei qidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaq afipppwfgeevtedkryknkalalsip
Timeline for d2fblb_: