SCOPe 2.01: Domain d2fblb_: 2fbl B:

Lineage for d2fblb_ (2fbl B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein Hypothetical protein NE1496 [143489] (1 species)
   shape-shifter; open beta-sheet instead of beta-barrel

7. Species Nitrosomonas europaea [TaxId:915] [143490] (1 PDB entry)
   Uniprot Q82UI9 2-151

8. Domain d2fblb_: 2fbl B: [133250]
   automated match to d2fbla1
   complexed with na

Details for d2fblb_

PDB Entry: 2fbl, 1.9 Å

PDB Description: the crystal structure of the hypothetical protein ne1496

PDB Compounds: (B:) hypothetical protein NE1496

SCOPe Domain Sequences for d2fblb_:

Sequence, based on SEQRES records:

>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqey
eiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflseda
aqafipppwfgeevtedkryknkalalsip

Sequence, based on observed residues (ATOM records):

>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseggrqeyei
qidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaq
afipppwfgeevtedkryknkalalsip

Timeline for d2fblb_:

• d2fblb_ first appeared in SCOP 1.73, called d2fblb1
  
• d2fblb_ was called d2fblb1 in SCOP 1.75
  
• d2fblb_ appears in SCOPe 2.02
  
• d2fblb_ appears in the current release, SCOPe 2.08