Lineage for d2fblb_ (2fbl B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523297Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2523298Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2523312Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2523313Protein Hypothetical protein NE1496 [143489] (1 species)
    shape-shifter; open beta-sheet instead of beta-barrel
  7. 2523314Species Nitrosomonas europaea [TaxId:915] [143490] (1 PDB entry)
    Uniprot Q82UI9 2-151
  8. 2523316Domain d2fblb_: 2fbl B: [133250]
    automated match to d2fbla1
    complexed with na

Details for d2fblb_

PDB Entry: 2fbl (more details), 1.9 Å

PDB Description: the crystal structure of the hypothetical protein ne1496
PDB Compounds: (B:) hypothetical protein NE1496

SCOPe Domain Sequences for d2fblb_:

Sequence, based on SEQRES records: (download)

>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqey
eiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflseda
aqafipppwfgeevtedkryknkalalsip

Sequence, based on observed residues (ATOM records): (download)

>d2fblb_ d.63.1.2 (B:) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseggrqeyei
qidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaq
afipppwfgeevtedkryknkalalsip

SCOPe Domain Coordinates for d2fblb_:

Click to download the PDB-style file with coordinates for d2fblb_.
(The format of our PDB-style files is described here.)

Timeline for d2fblb_: