Lineage for d2fbla1 (2fbl A:2-151)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through itSuperfamily d.63.1: CYTH-like phosphatases [55154] (3 families) 
Family d.63.1.2: CYTH domain [118007] (5 proteins)
Pfam PF01928
Protein Hypothetical protein NE1496 [143489] (1 species)
shape-shifter; open beta-sheet instead of beta-barrelSpecies Nitrosomonas europaea [TaxId:915] [143490] (1 PDB entry)
Uniprot Q82UI9 2-151
Domain d2fbla1: 2fbl A:2-151 [133249]
complexed with na
Details for d2fbla1
PDB Entry: 2fbl (more details), 1.9 Å
PDB Description: the crystal structure of the hypothetical protein ne1496
PDB Compounds: (A:) hypothetical protein NE1496SCOPe Domain Sequences for d2fbla1:
Sequence, based on SEQRES records: (download)
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqey
eiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflseda
aqafipppwfgeevtedkryknkalalsip
Sequence, based on observed residues (ATOM records): (download)
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksqeyeiqidv
tqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaqafip
ppwfgeevtedkryknkalalsip
SCOPe Domain Coordinates for d2fbla1:
Click to download the PDB-style file with coordinates for d2fbla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fbla1:
- d2fbla1 first appeared in SCOP 1.73
- d2fbla1 appears in SCOP 1.75
- d2fbla1 appears in SCOPe 2.02
- d2fbla1 appears in the current release, SCOPe 2.08
View in 3D
