Lineage for d2fblb1 (2fbl B:2-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864463Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 864464Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families) (S)
  5. 864474Family d.63.1.2: CYTH domain [118007] (4 proteins)
    Pfam PF01928
  6. 864475Protein Hypothetical protein NE1496 [143489] (1 species)
    shape-shifter; open beta-sheet instead of beta-barrel
  7. 864476Species Nitrosomonas europaea [TaxId:915] [143490] (1 PDB entry)
    Uniprot Q82UI9 2-151
  8. 864478Domain d2fblb1: 2fbl B:2-151 [133250]
    automatically matched to 2FBL A:2-151
    complexed with na

Details for d2fblb1

PDB Entry: 2fbl (more details), 1.9 Å

PDB Description: the crystal structure of the hypothetical protein ne1496
PDB Compounds: (B:) hypothetical protein NE1496

SCOP Domain Sequences for d2fblb1:

Sequence, based on SEQRES records: (download)

>d2fblb1 d.63.1.2 (B:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrqey
eiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflseda
aqafipppwfgeevtedkryknkalalsip

Sequence, based on observed residues (ATOM records): (download)

>d2fblb1 d.63.1.2 (B:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]}
teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseggrqeyei
qidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaq
afipppwfgeevtedkryknkalalsip

SCOP Domain Coordinates for d2fblb1:

Click to download the PDB-style file with coordinates for d2fblb1.
(The format of our PDB-style files is described here.)

Timeline for d2fblb1: