![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Manganese transport regulator MntR [88986] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
![]() | Domain d2f5fa1: 2f5f A:4-62 [132987] Other proteins in same PDB: d2f5fa2, d2f5fb2 automated match to d1on1a1 complexed with mn |
PDB Entry: 2f5f (more details), 2.4 Å
SCOPe Domain Sequences for d2f5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5fa1 a.4.5.24 (A:4-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
Timeline for d2f5fa1: