Lineage for d2f5fa2 (2f5f A:63-136)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718880Protein Manganese transport regulator MntR [89086] (1 species)
  7. 2718881Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 2718896Domain d2f5fa2: 2f5f A:63-136 [132988]
    Other proteins in same PDB: d2f5fa1, d2f5fb1
    automated match to d1on1a2
    complexed with mn

Details for d2f5fa2

PDB Entry: 2f5f (more details), 2.4 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to manganese, AC conformation, pH 8.5
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2f5fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5fa2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOPe Domain Coordinates for d2f5fa2:

Click to download the PDB-style file with coordinates for d2f5fa2.
(The format of our PDB-style files is described here.)

Timeline for d2f5fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5fa1