Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein automated matches [190102] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries) |
Domain d2f0xc_: 2f0x C: [132675] Other proteins in same PDB: d2f0xa1 automated match to d2f0xa1 complexed with so4 |
PDB Entry: 2f0x (more details), 2.3 Å
SCOPe Domain Sequences for d2f0xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0xc_ d.38.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn katgkliaqgrhtkhl
Timeline for d2f0xc_: