Lineage for d2f0xd_ (2f0x D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. Protein automated matches [190102] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries)
  8. Domain d2f0xd_: 2f0x D: [132676]
    Other proteins in same PDB: d2f0xa1
    automated match to d2f0xa1
    complexed with so4

Details for d2f0xd_

PDB Entry: 2f0x (more details), 2.3 Å

PDB Description: crystal structure and function of human thioesterase superfamily member 2(them2)
PDB Compounds: (D:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d2f0xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0xd_ d.38.1.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
atgkliaqgrhtkhl

SCOPe Domain Coordinates for d2f0xd_ are not available.

Timeline for d2f0xd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f0xa1, d2f0xb_, d2f0xc_, d2f0xe_, d2f0xf_, d2f0xg_, d2f0xh_