PDB entry 2f0x

View 2f0x on RCSB PDB site
Description: Crystal structure and function of human thioesterase superfamily member 2(THEM2)
Class: hydrolase
Keywords: hot dog fold, HYDROLASE
Deposited on 2005-11-14, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xa1
  • Chain 'B':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xb_
  • Chain 'C':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xc_
  • Chain 'D':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xd_
  • Chain 'E':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xe_
  • Chain 'F':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xf_
  • Chain 'G':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xg_
  • Chain 'H':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPJ3
      • modified residue (3)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.07: d2f0xh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f0xA (A:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xA (A:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f0xB (B:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xB (B:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f0xC (C:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xC (C:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f0xD (D:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xD (D:)
    mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
    vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
    atgkliaqgrhtkhl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f0xE (E:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xE (E:)
    mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
    vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
    atgkliaqgrhtkhl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f0xF (F:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xF (F:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f0xG (G:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xG (G:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2f0xH (H:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0xH (H:)
    mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
    vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
    atgkliaqgrhtkhl