Lineage for d2euna_ (2eun A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741332Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1741333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (176 PDB entries)
    Uniprot P00431
  8. 1741407Domain d2euna_: 2eun A: [132401]
    automated match to d1aa4__
    complexed with hem, lg3

Details for d2euna_

PDB Entry: 2eun (more details), 1.7 Å

PDB Description: cytochrome c peroxidase (ccp) in complex with 2,4-diaminopyrimidine
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d2euna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euna_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2euna_:

Click to download the PDB-style file with coordinates for d2euna_.
(The format of our PDB-style files is described here.)

Timeline for d2euna_: