SCOP 1.73: Domain d2euna1: 2eun A:4-294

Lineage for d2euna1 (2eun A:4-294)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)

8. Domain d2euna1: 2eun A:4-294 [132401]
   automatically matched to d1aa4__
   complexed with hem, lg3; mutant

Details for d2euna1

PDB Entry: 2eun, 1.7 Å

PDB Description: cytochrome c peroxidase (ccp) in complex with 2,4-diaminopyrimidine

PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d2euna1:

Sequence; same for both SEQRES and ATOM records:

>d2euna1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2euna1:

• d2euna1 is new in SCOP 1.73
  
• d2euna1 appears in SCOP 1.75
  
• d2euna1 appears in the current release, SCOPe 2.08, called d2euna2