![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries) Uniprot P00431 |
![]() | Domain d2euna2: 2eun A:4-294 [132401] Other proteins in same PDB: d2euna3 automated match to d1aa4__ complexed with hem, lg3 |
PDB Entry: 2eun (more details), 1.7 Å
SCOPe Domain Sequences for d2euna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2euna2 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
Timeline for d2euna2: