Lineage for d2einh_ (2ein H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714802Protein automated matches [190271] (1 species)
    not a true protein
  7. 2714803Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)
  8. 2714850Domain d2einh_: 2ein H: [132259]
    Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einh_

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2einh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d2einh_:

Click to download the PDB-style file with coordinates for d2einh_.
(The format of our PDB-style files is described here.)

Timeline for d2einh_: