![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries) |
![]() | Domain d2einh_: 2ein H: [132259] Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOPe Domain Sequences for d2einh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2einh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d2einh_:
![]() Domains from other chains: (mouse over for more information) d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ |