SCOPe 2.08: Domain d2einj_: 2ein J:

Lineage for d2einj_ (2ein J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family)
   automatically mapped to Pfam PF02238

5. Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)

8. Domain d2einj_: 2ein J: [132261]
   Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einx_, d2einy_, d2einz_
   automated match to d1ocrj_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einj_

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (J:) Cytochrome c oxidase polypeptide VIIa-heart

SCOPe Domain Sequences for d2einj_:

Sequence; same for both SEQRES and ATOM records:

>d2einj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

Timeline for d2einj_:

• d2einj_ first appeared in SCOP 1.73, called d2einj1
  
• d2einj_ appears in SCOPe 2.07