Lineage for d2einw_ (2ein W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025133Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 3025134Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 3025135Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025136Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)
  8. 3025223Domain d2einw_: 2ein W: [132275]
    Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einx_, d2einy_, d2einz_
    automated match to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einw_

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (W:) Cytochrome c oxidase polypeptide VIIa-heart

SCOPe Domain Sequences for d2einw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d2einw_:

Click to download the PDB-style file with coordinates for d2einw_.
(The format of our PDB-style files is described here.)

Timeline for d2einw_: