SCOPe 2.08: Domain d2einx_: 2ein X:

Lineage for d2einx_ (2ein X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries)

8. Domain d2einx_: 2ein X: [132276]
   Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einy_, d2einz_
   automated match to d1occk_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einx_

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (X:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2einx_:

Sequence; same for both SEQRES and ATOM records:

>d2einx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d2einx_:

• d2einx_ first appeared in SCOP 1.73, called d2einx1
  
• d2einx_ appears in SCOPe 2.07