SCOPe 2.08: Domain d2eijg_: 2eij G:

Lineage for d2eijg_ (2eij G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)

8. Domain d2eijg_: 2eij G: [132146]
   Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_
   automated match to d1occg_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijg_

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d2eijg_:

Sequence; same for both SEQRES and ATOM records:

>d2eijg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2eijg_:

• d2eijg_ first appeared in SCOP 1.73, called d2eijg1
  
• d2eijg_ appears in SCOPe 2.07