Lineage for d2eijb2 (2eij B:1-90)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2577345Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2577346Species Cow (Bos taurus) [TaxId:9913] [81454] (37 PDB entries)
  8. 2577361Domain d2eijb2: 2eij B:1-90 [132141]
    Other proteins in same PDB: d2eija_, d2eijb1, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijb2

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2eijb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2eijb2:

Click to download the PDB-style file with coordinates for d2eijb2.
(The format of our PDB-style files is described here.)

Timeline for d2eijb2: