Lineage for d2eijh_ (2eij H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714802Protein automated matches [190271] (1 species)
    not a true protein
  7. 2714803Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries)
  8. 2714812Domain d2eijh_: 2eij H: [132147]
    Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijh_

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2eijh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d2eijh_:

Click to download the PDB-style file with coordinates for d2eijh_.
(The format of our PDB-style files is described here.)

Timeline for d2eijh_: