SCOPe 2.08: Domain d2eghb1: 2egh B:301-397

Lineage for d2eghb1 (2egh B:301-397)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family)

5. Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)

7. Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)
   Uniprot P45568

8. Domain d2eghb1: 2egh B:301-397 [132124]
   Other proteins in same PDB: d2egha2, d2egha3, d2egha4, d2egha5, d2eghb2, d2eghb3, d2eghb4
   automatically matched to d1jvsa1
   complexed with fom, mg, ndp

Details for d2eghb1

PDB Entry: 2egh, 2.2 Å

PDB Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase complexed with a magnesium ion, NADPH and fosmidomycin

PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d2eghb1:

Sequence; same for both SEQRES and ATOM records:

>d2eghb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlas

Timeline for d2eghb1:

• d2eghb1 first appeared in SCOP 1.73
  
• d2eghb1 appears in SCOPe 2.07