Lineage for d2egha1 (2egh A:301-397)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000218Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2000526Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 2000527Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 2000528Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 2000529Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)
    Uniprot P45568
  8. 2000535Domain d2egha1: 2egh A:301-397 [132121]
    Other proteins in same PDB: d2egha2, d2egha3, d2egha4, d2egha5, d2eghb2, d2eghb3, d2eghb4
    automatically matched to d1jvsa1
    complexed with fom, mg, ndp

Details for d2egha1

PDB Entry: 2egh (more details), 2.2 Å

PDB Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase complexed with a magnesium ion, NADPH and fosmidomycin
PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d2egha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egha1 a.69.3.1 (A:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlas

SCOPe Domain Coordinates for d2egha1:

Click to download the PDB-style file with coordinates for d2egha1.
(The format of our PDB-style files is described here.)

Timeline for d2egha1: