Lineage for d2eghb2 (2egh B:1-125,B:275-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843544Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 2843545Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
    Uniprot P45568
  8. 2843547Domain d2eghb2: 2egh B:1-125,B:275-300 [132125]
    Other proteins in same PDB: d2egha1, d2egha3, d2egha4, d2egha5, d2eghb1, d2eghb3, d2eghb4
    automatically matched to d1jvsa2
    complexed with fom, mg, ndp

Details for d2eghb2

PDB Entry: 2egh (more details), 2.2 Å

PDB Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase complexed with a magnesium ion, NADPH and fosmidomycin
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d2eghb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eghb2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
kqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddeas
akllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagktil
lankeXmrtpiahtmawpnrvnsgvkpldfck

SCOPe Domain Coordinates for d2eghb2:

Click to download the PDB-style file with coordinates for d2eghb2.
(The format of our PDB-style files is described here.)

Timeline for d2eghb2: