PDB entry 2egh

View 2egh on RCSB PDB site
Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase complexed with a magnesium ion, NADPH and fosmidomycin
Class: Oxidoreductase
Keywords: Protein-inhibitor complex, Oxidoreductase
Deposited on 2007-03-01, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: dxr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (11-407)
      • cloning artifact (10)
      • cloning artifact (408-409)
    Domains in SCOPe 2.07: d2egha1, d2egha2, d2egha3, d2egha4, d2egha5
  • Chain 'B':
    Compound: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: dxr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45568 (11-407)
      • cloning artifact (10)
    Domains in SCOPe 2.07: d2eghb1, d2eghb2, d2eghb3, d2eghb4
  • Heterogens: MG, FOM, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eghA (A:)
    mrgshhhhhhgkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefs
    pryavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllpt
    laairagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgy
    adleqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgl
    eyiearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrv
    nsgvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqq
    irftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlassacdlgtpgrpa
    akln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eghA (A:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlassa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eghB (B:)
    mrgshhhhhhgkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefs
    pryavmddeasakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllpt
    laairagktillankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgy
    adleqngvvsilltgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgl
    eyiearwlfnasasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrv
    nsgvkpldfcklsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqq
    irftdiaalnlsvlekmdmrepqcvddvlsvdanarevarkevmrlassacdlgtpgrpa
    akln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eghB (B:)
    gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
    sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
    llankeslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvs
    illtgsggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfn
    asasqmevlihpqsvihsmvryqdgsvlaqlgepdmrtpiahtmawpnrvnsgvkpldfc
    klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
    lsvlekmdmrepqcvddvlsvdanarevarkevmrlas