Lineage for d2e2ji2 (2e2j I:50-120)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066047Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1066048Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 1066049Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 1066050Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 1066078Domain d2e2ji2: 2e2j I:50-120 [132016]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i3qi2
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2ji2

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2e2ji2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ji2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOPe Domain Coordinates for d2e2ji2:

Click to download the PDB-style file with coordinates for d2e2ji2.
(The format of our PDB-style files is described here.)

Timeline for d2e2ji2: