Lineage for d2e2ji2 (2e2j I:50-120)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750747Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 750748Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 750749Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 750752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
  8. 750778Domain d2e2ji2: 2e2j I:50-120 [132016]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i3qi2
    complexed with g2p, mg, zn

Details for d2e2ji2

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with GMPCPP
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2e2ji2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ji2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOP Domain Coordinates for d2e2ji2:

Click to download the PDB-style file with coordinates for d2e2ji2.
(The format of our PDB-style files is described here.)

Timeline for d2e2ji2: