| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) ![]() |
| Family d.78.1.1: RPB5 [55288] (2 proteins) |
| Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d2e2je2: 2e2j E:144-215 [132012] Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1 automatically matched to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2e2j (more details), 3.5 Å
SCOPe Domain Sequences for d2e2je2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2je2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm
Timeline for d2e2je2: