SCOPe 2.08: Domain d2e2je2: 2e2j E:144-215

Lineage for d2e2je2 (2e2j E:144-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2e2je2: 2e2j E:144-215 [132012]
   Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
   automatically matched to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2je2

PDB Entry: 2e2j, 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2e2je2:

Sequence; same for both SEQRES and ATOM records:

>d2e2je2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d2e2je2:

• d2e2je2 first appeared in SCOP 1.73
  
• d2e2je2 appears in SCOPe 2.07