Lineage for d2e1ra2 (2e1r A:1-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111132Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 2111140Domain d2e1ra2: 2e1r A:1-343 [131967]
    Other proteins in same PDB: d2e1ra1, d2e1ra3, d2e1ra4, d2e1ra5
    automated match to d1n0ua2
    complexed with gdp, sod

Details for d2e1ra2

PDB Entry: 2e1r (more details), 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2e1ra2:

Sequence, based on SEQRES records: (download)

>d2e1ra2 c.37.1.8 (A:1-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d2e1ra2 c.37.1.8 (A:1-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakergitiksta
islysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtieg
vcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyad
evlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpkt
kkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdl
egkallkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d2e1ra2:

Click to download the PDB-style file with coordinates for d2e1ra2.
(The format of our PDB-style files is described here.)

Timeline for d2e1ra2: