Lineage for d2e1ra1 (2e1r A:344-481)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)
  8. 2793325Domain d2e1ra1: 2e1r A:344-481 [131966]
    Other proteins in same PDB: d2e1ra2, d2e1ra3, d2e1ra4, d2e1ra5
    automated match to d1n0ua1
    complexed with gdp, sod

Details for d2e1ra1

PDB Entry: 2e1r (more details), 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2e1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1ra1 b.43.3.0 (A:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d2e1ra1:

Click to download the PDB-style file with coordinates for d2e1ra1.
(The format of our PDB-style files is described here.)

Timeline for d2e1ra1: