SCOPe 2.08: Domain d2dw6a1: 2dw6 A:143-389

Lineage for d2dw6a1 (2dw6 A:143-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [255123] (2 PDB entries)

8. Domain d2dw6a1: 2dw6 A:143-389 [131808]
   Other proteins in same PDB: d2dw6a2, d2dw6b2, d2dw6c2, d2dw6d2
   automated match to d1tzza1
   complexed with mg, tar, tla; mutant

Details for d2dw6a1

PDB Entry: 2dw6, 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate

PDB Compounds: (A:) Bll6730 protein

SCOPe Domain Sequences for d2dw6a1:

Sequence; same for both SEQRES and ATOM records:

>d2dw6a1 c.1.11.2 (A:143-389) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmaiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

Timeline for d2dw6a1:

• d2dw6a1 first appeared in SCOP 1.73
  
• d2dw6a1 appears in SCOPe 2.07