PDB entry 2dw6

View 2dw6 on RCSB PDB site
Description: Crystal structure of the mutant K184A of D-Tartrate Dehydratase from Bradyrhizobium japonicum complexed with Mg++ and D-tartrate
Class: lyase
Keywords: D-Tartrate Dehydratase, Enolase superfamily, D-tartrate, L-tartrate, LYASE
Deposited on 2006-08-07, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89FH0 (Start-388)
      • engineered (183)
    Domains in SCOPe 2.07: d2dw6a1, d2dw6a2
  • Chain 'B':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89FH0 (Start-388)
      • engineered (183)
    Domains in SCOPe 2.07: d2dw6b1, d2dw6b2
  • Chain 'C':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89FH0 (Start-388)
      • engineered (183)
    Domains in SCOPe 2.07: d2dw6c1, d2dw6c2
  • Chain 'D':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89FH0 (Start-388)
      • engineered (183)
    Domains in SCOPe 2.07: d2dw6d1, d2dw6d2
  • Heterogens: MG, TLA, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dw6A (A:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw6A (A:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dw6B (B:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw6B (B:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dw6C (C:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw6C (C:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dw6D (D:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw6D (D:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmaiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae