Lineage for d2dw6a1 (2dw6 A:143-389)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 684589Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 684647Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 684695Protein Hypothetical protein Bll6730 [117384] (1 species)
  7. 684696Species Bradyrhizobium japonicum [TaxId:375] [117385] (3 PDB entries)
  8. 684699Domain d2dw6a1: 2dw6 A:143-389 [131808]
    Other proteins in same PDB: d2dw6a2, d2dw6b2, d2dw6c2, d2dw6d2
    automatically matched to d1tzza1
    complexed with mg, tar, tla; mutant

Details for d2dw6a1

PDB Entry: 2dw6 (more details), 2.3 Å

PDB Description: Crystal structure of the mutant K184A of D-Tartrate Dehydratase from Bradyrhizobium japonicum complexed with Mg++ and D-tartrate
PDB Compounds: (A:) Bll6730 protein

SCOP Domain Sequences for d2dw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw6a1 c.1.11.2 (A:143-389) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmaiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

SCOP Domain Coordinates for d2dw6a1:

Click to download the PDB-style file with coordinates for d2dw6a1.
(The format of our PDB-style files is described here.)

Timeline for d2dw6a1: