SCOPe 2.08: Domain d2dw6d2: 2dw6 D:2-142

Lineage for d2dw6d2 (2dw6 D:2-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [255122] (2 PDB entries)

8. Domain d2dw6d2: 2dw6 D:2-142 [131815]
   Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1
   automated match to d1tzza2
   complexed with mg, tar, tla; mutant

Details for d2dw6d2

PDB Entry: 2dw6, 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate

PDB Compounds: (D:) Bll6730 protein

SCOPe Domain Sequences for d2dw6d2:

Sequence; same for both SEQRES and ATOM records:

>d2dw6d2 d.54.1.0 (D:2-142) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

Timeline for d2dw6d2:

• d2dw6d2 first appeared in SCOP 1.73
  
• d2dw6d2 appears in SCOPe 2.07