SCOPe 2.08: Domain d2dctb_: 2dct B:

Lineage for d2dctb_ (2dct B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.9: TM1287-like [89409] (5 proteins)

6. Protein automated matches [190265] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187054] (1 PDB entry)

8. Domain d2dctb_: 2dct B: [131387]
   Other proteins in same PDB: d2dcta1
   automated match to d1v70a_
   complexed with cl, na

Details for d2dctb_

PDB Entry: 2dct, 1.45 Å

PDB Description: Crystal structure of the TT1209 from Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TTHA0104

SCOPe Domain Sequences for d2dctb_:

Sequence; same for both SEQRES and ATOM records:

>d2dctb_ b.82.1.9 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp

Timeline for d2dctb_:

• d2dctb_ first appeared in SCOP 1.73, called d2dctb1
  
• d2dctb_ appears in SCOPe 2.07