![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.9: TM1287-like [89409] (5 proteins) |
![]() | Protein automated matches [190265] (1 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187054] (1 PDB entry) |
![]() | Domain d2dctb_: 2dct B: [131387] Other proteins in same PDB: d2dcta1 automated match to d1v70a_ complexed with cl, na |
PDB Entry: 2dct (more details), 1.45 Å
SCOPe Domain Sequences for d2dctb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dctb_ b.82.1.9 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp
Timeline for d2dctb_: