SCOPe 2.08: Domain d2dcta1: 2dct A:1-105

Lineage for d2dcta1 (2dct A:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.9: TM1287-like [89409] (5 proteins)

6. Protein Hypothetical protein TTHA0104 [117310] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117311] (2 PDB entries)
   Uniprot Q5SM39

8. Domain d2dcta1: 2dct A:1-105 [131386]
   Other proteins in same PDB: d2dctb_
   complexed with cl, na

Details for d2dcta1

PDB Entry: 2dct, 1.45 Å

PDB Description: Crystal structure of the TT1209 from Thermus thermophilus HB8

PDB Compounds: (A:) hypothetical protein TTHA0104

SCOPe Domain Sequences for d2dcta1:

Sequence; same for both SEQRES and ATOM records:

>d2dcta1 b.82.1.9 (A:1-105) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp

Timeline for d2dcta1:

• d2dcta1 first appeared in SCOP 1.73
  
• d2dcta1 appears in SCOPe 2.07