Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.9: TM1287-like [89409] (5 proteins) |
Protein Hypothetical protein TTHA0104 [117310] (1 species) |
Species Thermus thermophilus [TaxId:274] [117311] (2 PDB entries) Uniprot Q5SM39 |
Domain d2dcta1: 2dct A:1-105 [131386] Other proteins in same PDB: d2dctb_ complexed with cl, na |
PDB Entry: 2dct (more details), 1.45 Å
SCOPe Domain Sequences for d2dcta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dcta1 b.82.1.9 (A:1-105) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp
Timeline for d2dcta1: