Lineage for d2dctb1 (2dct B:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677513Family b.82.1.9: TM1287-like [89409] (4 proteins)
  6. 677527Protein Hypothetical protein TTHA0104 [117310] (1 species)
  7. 677528Species Thermus thermophilus [TaxId:274] [117311] (2 PDB entries)
  8. 677531Domain d2dctb1: 2dct B:1-105 [131387]
    automatically matched to 2DCT A:1-105
    complexed with cl, na

Details for d2dctb1

PDB Entry: 2dct (more details), 1.45 Å

PDB Description: Crystal structure of the TT1209 from Thermus thermophilus HB8
PDB Compounds: (B:) hypothetical protein TTHA0104

SCOP Domain Sequences for d2dctb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dctb1 b.82.1.9 (B:1-105) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]}
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp

SCOP Domain Coordinates for d2dctb1:

Click to download the PDB-style file with coordinates for d2dctb1.
(The format of our PDB-style files is described here.)

Timeline for d2dctb1: