Lineage for d2cz4b2 (2cz4 B:2-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950565Protein Hypothetical protein TTHA0516 [143281] (1 species)
  7. 2950566Species Thermus thermophilus [TaxId:274] [143282] (1 PDB entry)
    Uniprot Q5SKX7 1-100
  8. 2950568Domain d2cz4b2: 2cz4 B:2-100 [131036]
    Other proteins in same PDB: d2cz4a2, d2cz4b3, d2cz4c3
    automated match to d2cz4a1
    complexed with act, cl

Details for d2cz4b2

PDB Entry: 2cz4 (more details), 1.93 Å

PDB Description: Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
PDB Compounds: (B:) hypothetical protein TTHA0516

SCOPe Domain Sequences for d2cz4b2:

Sequence, based on SEQRES records: (download)

>d2cz4b2 d.58.5.1 (B:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
dlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirleti
vseevalrilqrlqeeyfphyaviayvenvwvvrgekyv

Sequence, based on observed residues (ATOM records): (download)

>d2cz4b2 d.58.5.1 (B:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
dlvplklvtivaesllekrlveevkrlgakgytitpargegdwegqnirletivseeval
rilqrlqeeyfphyaviayvenvwvvrgekyv

SCOPe Domain Coordinates for d2cz4b2:

Click to download the PDB-style file with coordinates for d2cz4b2.
(The format of our PDB-style files is described here.)

Timeline for d2cz4b2: