SCOPe 2.08: Domain d2cz4c2: 2cz4 C:2-100

Lineage for d2cz4c2 (2cz4 C:2-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein Hypothetical protein TTHA0516 [143281] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143282] (1 PDB entry)
   Uniprot Q5SKX7 1-100

8. Domain d2cz4c2: 2cz4 C:2-100 [131037]
   Other proteins in same PDB: d2cz4a2, d2cz4b3, d2cz4c3
   automated match to d2cz4a1
   complexed with act, cl

Details for d2cz4c2

PDB Entry: 2cz4, 1.93 Å

PDB Description: Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8

PDB Compounds: (C:) hypothetical protein TTHA0516

SCOPe Domain Sequences for d2cz4c2:

Sequence, based on SEQRES records:

>d2cz4c2 d.58.5.1 (C:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
dlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirleti
vseevalrilqrlqeeyfphyaviayvenvwvvrgekyv

Sequence, based on observed residues (ATOM records):

>d2cz4c2 d.58.5.1 (C:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]}
dlvplklvtivaesllekrlveevkrlgakgytitpargegsegqnirletivseevalr
ilqrlqeeyfphyaviayvenvwvvrgekyv

Timeline for d2cz4c2:

• d2cz4c2 first appeared in SCOP 1.73, called d2cz4c1
  
• d2cz4c2 appears in SCOPe 2.07