PDB entry 2cz4

View 2cz4 on RCSB PDB site
Description: Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Conserved hypothetical protein, PII-like signaling protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-07-10, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0516
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0516
    Database cross-references and differences (RAF-indexed):
    • GB YP_143782 (19-118)
      • modified residue (19)
    Domains in SCOPe 2.08: d2cz4a1, d2cz4a2
  • Chain 'B':
    Compound: hypothetical protein TTHA0516
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0516
    Database cross-references and differences (RAF-indexed):
    • GB YP_143782 (19-118)
      • modified residue (19)
    Domains in SCOPe 2.08: d2cz4b2, d2cz4b3
  • Chain 'C':
    Compound: hypothetical protein TTHA0516
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0516
    Database cross-references and differences (RAF-indexed):
    • GB YP_143782 (19-118)
      • modified residue (19)
    Domains in SCOPe 2.08: d2cz4c2, d2cz4c3
  • Heterogens: CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cz4A (A:)
    gsshhhhhhssglvprgshmdlvplklvtivaesllekrlveevkrlgakgytitparge
    gsrgirsvdwegqnirletivseevalrilqrlqeeyfphyaviayvenvwvvrgekyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cz4A (A:)
    mdlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirlet
    ivseevalrilqrlqeeyfphyaviayvenvwvvrgekyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cz4B (B:)
    gsshhhhhhssglvprgshmdlvplklvtivaesllekrlveevkrlgakgytitparge
    gsrgirsvdwegqnirletivseevalrilqrlqeeyfphyaviayvenvwvvrgekyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cz4B (B:)
    mdlvplklvtivaesllekrlveevkrlgakgytitpargegdwegqnirletivseeva
    lrilqrlqeeyfphyaviayvenvwvvrgekyv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cz4C (C:)
    gsshhhhhhssglvprgshmdlvplklvtivaesllekrlveevkrlgakgytitparge
    gsrgirsvdwegqnirletivseevalrilqrlqeeyfphyaviayvenvwvvrgekyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cz4C (C:)
    mdlvplklvtivaesllekrlveevkrlgakgytitpargegsegqnirletivseeval
    rilqrlqeeyfphyaviayvenvwvvrgekyv