![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
![]() | Protein Hypothetical protein TTHA0516 [143281] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143282] (1 PDB entry) Uniprot Q5SKX7 1-100 |
![]() | Domain d2cz4a1: 2cz4 A:2-100 [131035] Other proteins in same PDB: d2cz4a2, d2cz4b3, d2cz4c3 complexed with act, cl |
PDB Entry: 2cz4 (more details), 1.93 Å
SCOPe Domain Sequences for d2cz4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz4a1 d.58.5.1 (A:2-100) Hypothetical protein TTHA0516 {Thermus thermophilus [TaxId: 274]} dlvplklvtivaesllekrlveevkrlgakgytitpargegsrgirsvdwegqnirleti vseevalrilqrlqeeyfphyaviayvenvwvvrgekyv
Timeline for d2cz4a1:
![]() Domains from other chains: (mouse over for more information) d2cz4b2, d2cz4b3, d2cz4c2, d2cz4c3 |