SCOPe 2.01: Domain d2cxda_: 2cxd A:

Lineage for d2cxda_ (2cxd A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.2: TTHA0068-like [140663] (1 family)

5. Family a.246.2.1: TTHA0068-like [140664] (3 proteins)
   Pfam PF03745; DUF309

6. Protein automated matches [190577] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187578] (1 PDB entry)

8. Domain d2cxda_: 2cxd A: [130994]
   automated match to d2cwya1

Details for d2cxda_

PDB Entry: 2cxd, 2 Å

PDB Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8

PDB Compounds: (A:) conserved hypothetical protein, TTHA0068

SCOPe Domain Sequences for d2cxda_:

Sequence; same for both SEQRES and ATOM records:

>d2cxda_ a.246.2.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
nlrkaearleglpcplmgldwrsllqearrrlga

Timeline for d2cxda_:

• d2cxda_ first appeared in SCOP 1.73, called d2cxda1
  
• d2cxda_ was called d2cxda1 in SCOP 1.75
  
• d2cxda_ appears in SCOPe 2.02
  
• d2cxda_ appears in the current release, SCOPe 2.08