PDB entry 2cxd

View 2cxd on RCSB PDB site
Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Structural Genomics, conserved hypothetical protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein, TTHA0068
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM75 (0-93)
      • modified residue (0)
      • modified residue (76)
    Domains in SCOPe 2.01: d2cxda_
  • Chain 'B':
    Compound: conserved hypothetical protein, TTHA0068
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM75 (0-93)
      • modified residue (0)
      • modified residue (76)
    Domains in SCOPe 2.01: d2cxdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cxdA (A:)
    mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
    nlrkaearleglpcplmgldwrsllqearrrlga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cxdB (B:)
    mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
    nlrkaearleglpcplmgldwrsllqearrrlga