Class a: All alpha proteins [46456] (290 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.2: TTHA0068-like [140663] (1 family) |
Family a.246.2.1: TTHA0068-like [140664] (3 proteins) Pfam PF03745; DUF309 |
Protein automated matches [190577] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187578] (1 PDB entry) |
Domain d2cxda_: 2cxd A: [130994] automated match to d2cwya1 |
PDB Entry: 2cxd (more details), 2 Å
SCOPe Domain Sequences for d2cxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxda_ a.246.2.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr nlrkaearleglpcplmgldwrsllqearrrlga
Timeline for d2cxda_: